PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016479548.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 282aa    MW: 31947.9 Da    PI: 5.2068
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016479548.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.81e-1272112648
                      HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   6 teEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +eE e  ++  ++lG++ W+tIa++++ gRt++++k++++++l
   XP_016479548.1  72 EEERETVIKTYQELGNR-WSTIAARLP-GRTDNEVKNFFHTHL 112
                      688889***********.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.02E-1252116IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-1957116IPR009057Homeodomain-like
PROSITE profilePS5129416.08360116IPR017930Myb domain
SMARTSM007175.1E-864114IPR001005SANT/Myb domain
PfamPF002491.0E-1072112IPR001005SANT/Myb domain
CDDcd001671.35E-872112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDQISGAPPL LKWSDSKKYT QLPYKPSATP ELIPKRFKMP DVSKYNGTSD TEEHITAYLC  60
PDVMRGPFSI EEEERETVIK TYQELGNRWS TIAARLPGRT DNEVKNFFHT HLKKHLGLKY  120
DAPLKSTSRA RDNKRVLKKT KGNERTNADK RSPGHVSSSD SSNSITFEAN QMMDATMSLY  180
QTDGACYNVV DQPNIEMEIS PVILESNPET TSGINLGIAT CQLCQFEYPH PCTISDTATV  240
DFFDQFDHQI IWQQFLELVG VSDSILDEFF DSSFVAAMTK YM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016479548.10.0PREDICTED: transcription repressor MYB4-like
TrEMBLK4BIR81e-52K4BIR8_SOLLC; Uncharacterized protein
STRINGSolyc03g093930.2.14e-52(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2432022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.16e-21myb domain protein 58